PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK36882.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 362aa    MW: 40729.8 Da    PI: 6.7714
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK36882.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65e-174590147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++e d  l ++v++lG+++W++I+r ++ gR++k+c++rw + 
       KFK36882.1 45 KGPWSPEQDAALTRLVNKLGPRNWTLISRGIP-GRSGKSCRLRWCNQ 90
                     79******************************.***********985 PP

2Myb_DNA-binding45.41.9e-1497140146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+++T+eEd  +  a++ +G++ W  Ia+ ++ gRt++ +k++w++
       KFK36882.1  97 RKPFTEEEDNMIMSAHAVHGNK-WCVIAKLLP-GRTDNGIKNHWNS 140
                      789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.8424095IPR017930Myb domain
SuperFamilySSF466892.71E-3042138IPR009057Homeodomain-like
SMARTSM007171.5E-144493IPR001005SANT/Myb domain
PfamPF002496.2E-164590IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-244698IPR009057Homeodomain-like
CDDcd001676.12E-134789No hitNo description
PROSITE profilePS5129420.15296146IPR017930Myb domain
SMARTSM007171.7E-1396144IPR001005SANT/Myb domain
PfamPF002495.2E-1397140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2399145IPR009057Homeodomain-like
CDDcd001676.26E-1099139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MNAEIAPATD FDESEDATNV AVDLELAELA RRESESNGFG KSKVKGPWSP EQDAALTRLV  60
NKLGPRNWTL ISRGIPGRSG KSCRLRWCNQ LDPVLKRKPF TEEEDNMIMS AHAVHGNKWC  120
VIAKLLPGRT DNGIKNHWNS ALRRKQEDLW NNTVIKKEKI SNASTKEDLP RGEEINSSNN  180
PLIVIDDEAD EARERNCKPN VYRPVARFGG VSVVYKPGYM NSNIVPREGP LVQGSRRDSL  240
SGKFLQSLCY EPNIPTKCGH GCCTDQDKRL LSSVNSVLGS EFVDYEEPSS DVLDQELVCL  300
ATDLNNVAWI KSGLNRSYFR EVEQSLKVDE HFRHDYARPK FTGMVNNGIS SEMMRQDLRA  360
FS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-37441456107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881682.11e-168predicted protein
TrEMBLA0A087H4300.0A0A087H430_ARAAL; Uncharacterized protein
STRINGAl_scaffold_0004_25721e-167(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56382747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G39880.11e-143myb domain protein 25